DPCstruct | MC20730
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 96 ± 16 aa |
| Standard deviation of domain lengths | 16.07 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 41.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C2BQR2 | 9-101 | VAKIRAAAEKATTQKYNAMMMLPGTVIAMCDRIEDLSPFEALEENSWDLRCVNVPTGGDDYDIIWEVIEHYQATPRNRTIAGGITPV… |
| A0A841QFV6 | 68-145 | LEAEHRAEQRARAEIGRDSERLDWLESGCCDVRFRSEPIADTGDADVYCDIIQHHMAKPYERTIGSAETIRSAIDAAR |
| A0A387AN18 | 7-82 | None |
| A0A810XWR3 | 152-258 | None |
| A0A6L3Z4R7 | 118-206 | None |
| A0A811H177 | 86-172 | None |
| A0A136QBG4 | 47-152 | None |
| A0A1A5XAY7 | 316-430 | None |
| A0A2N5C415 | 74-175 | None |
| A0A0S9MUI1 | 34-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.