DPCstruct | MC20729
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 66 ± 12 aa |
| Standard deviation of domain lengths | 12.48 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 89.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 51.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0270 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W1BJI3 | 1-59 | MYHDQGLAPLKALYFDEGINVSLNLPIKRSSVDHGTAFDIAYKGVKLNNLSYLNAIEFI |
| A0A7C1E962 | 57-121 | VVAMYHDQGLIPVKMLAFDRAVNVTIGLPIIRTSPAHGTAFDIAGKGLAKPDSMKSAIKTAIDMA |
| A0A7J4NWN0 | 2-92 | None |
| A0A7V1I3W4 | 17-81 | None |
| A0A559U4W9 | 79-159 | None |
| A0A5Q5FY94 | 1-66 | None |
| A0A3B0RSM1 | 3-58 | None |
| A0A833D2L8 | 91-163 | None |
| A0A7C1I4T1 | 22-69 | None |
| A0A7V5UKI2 | 201-269 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.