DPCstruct | MC20726
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 82 ± 10 aa |
| Standard deviation of domain lengths | 10.34 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 35.23 |
| Pfam Score | 97.22 |
| Assigned Pfam label(s) | CL0167- PF19769- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A177EYK8 | 100-169 | EPTNHNHKNPRLPQRTPATAFDCHFCNARKAVKVKVDEKAGRGSLKCKNCHIKFACAVDNLSAAVDVHAA |
| A0A7M7RGD1 | 1-79 | MGRRRAKKKPPQKKKMLGTLETQFTCPFCNHEKSCDVKMDRTRNVGVISCRVCLEDFQTSITYLSEPVDVYSDWIDACE |
| F2RNK9 | 81-166 | None |
| A0A3N7HI58 | 39-123 | None |
| A0A7C2ZBD4 | 2-63 | None |
| A0A0G4HF22 | 1-86 | None |
| A0A1Q9CL99 | 921-1009 | None |
| A0A6G1IPT1 | 130-220 | None |
| A0A3Q7QYT5 | 1-63 | None |
| A0A835XNX1 | 1-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.