DPCstruct | MC20721
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 133 ± 14 aa |
| Standard deviation of domain lengths | 13.84 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 68.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M7T343 | 39-179 | IKKTATVSLRQLLLRAGDVEMNPGPKYRSIGPLQERELLSLAHDVSPEYYNTVCIALGFTHARSKIILTKNLLDVSASVFDILCMWK… |
| A0A7M7PGG3 | 1-123 | MEPLQDIELISLAEDIGPGKYSKLCNALGYSYAVSQSHIVKHLNNVNEALVELLIKWNNNQGDSTQTRSILASKLHELRLGNLGDRL… |
| A0A2G8KA22 | 4-148 | None |
| A0A7M7PD44 | 1-113 | None |
| A0A7M7PB69 | 21-172 | None |
| A0A7M7P3S6 | 261-384 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.