DPCstruct | MC2072
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 299 ± 25 aa |
| Standard deviation of domain lengths | 24.88 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 78.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 31.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5P2CDB4 | 486-796 | SASVAFLSLATETATLTALGVLAALHLAACVRLARAGSPAPDTAALAACASLVSALALVCASGAAWGLRPEHIGLLSLTVPALAAAA… |
| A0A1S2K9V0 | 1-320 | MAAVGFGGAVAAASTVAVQGLVTEAATLAVLGSLAALFAGASAVGGARPWLRAASACGAVVAAAGFVGAAGAAAGWPVHAVAVALLV… |
| A0A7C1D034 | 676-1004 | None |
| A0A7K2XZL3 | 199-503 | None |
| A0A6J4MHW4 | 1-308 | None |
| A0A847CNM6 | 1-245 | None |
| A0A6H3ISU8 | 27-337 | None |
| A0A7J0C0J1 | 440-735 | None |
| A0A6G6WK26 | 373-641 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.