DPCstruct | MC20718
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 73 ± 6 aa |
| Standard deviation of domain lengths | 5.56 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 50.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E4TMA6 | 1-71 | MKPELFKQPFKYMRWCAHHYPAYFFSLLLGFSFPVAALAVTPLRRKFLYDDHIPIPRTYPLPRRAREPLTG |
| K1Y167 | 1-64 | MSNAIPRFWSQPIRYLRWASIEKPAIFYSLIIGSMGPVVAMTVPPIRNMLGDHKRPEIPLTYPS |
| A0A5N6K1I4 | 1-76 | None |
| A0A6A6UN10 | 25-94 | None |
| A0A179HJH0 | 29-99 | None |
| A0A2S7XXK3 | 78-148 | None |
| A0A4Q4YKK8 | 1-81 | None |
| A0A2A9PQ19 | 42-124 | None |
| A0A3N4LR91 | 1-64 | None |
| C5P535 | 68-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.