DPCstruct | MC20715
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 205 ± 23 aa |
| Standard deviation of domain lengths | 23.03 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 73.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 23.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12326 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J0CY46 | 196-380 | ARLPTARIHPSSRTDAPPRALDFIYGASEALAVIPAFLGTIYLGTQALSVRPNLYPTTLDYVVAALWAILTGYQCLCLASGLLTRWR… |
| A0A1E4TDN0 | 2-186 | NSVSSRPKPLRLLPRKTAWTIRLCSWMSLVGSLYSAVYCISTAANMPPECKGAVRPIELVLAAIWCIVGTYLTRALINGLLLRWLVY… |
| A0A0W4ZRJ0 | 6-220 | None |
| A0A1L0D368 | 149-353 | None |
| A0A367K661 | 1-204 | None |
| A0A197JUQ9 | 49-303 | None |
| A0A420YC55 | 34-268 | None |
| A0A1B9HFB9 | 732-961 | None |
| A0A2Z6RIX2 | 5-198 | None |
| A0A7C8JTY9 | 55-245 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.