DPCstruct | MC20714
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 336 ± 60 aa |
| Standard deviation of domain lengths | 59.57 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 70.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 25.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10281 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V8SQW8 | 1-274 | MKFSLASMAVVALATQTATADWFGGSTARVAYNKWHETELERWLSDHNVPYPTPSDRKDLQNLVQKNWDSNVVQPYNSWDTNQLSSY… |
| A0A1E4TAZ3 | 1-338 | MKFSILCTAFLSISSIVSAVDVYKSWTDSDLRAWLADQGIVVAPDTPRKSLLKDVEKNWDSVITKAYDSWSDSNIADYLRDAGFKVQ… |
| S3BZL5 | 1-309 | None |
| A0A1B7TAS1 | 56-273 | None |
| A0A376B6Y0 | 22-326 | None |
| A0A6G1G423 | 1-353 | None |
| I4Y8Z0 | 1-473 | None |
| A0A0C9UDV2 | 1-386 | None |
| A0A421J6F2 | 17-315 | None |
| A0A1W5CUJ9 | 1-324 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.