DPCstruct | MC20713
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 409 ± 64 aa |
| Standard deviation of domain lengths | 63.96 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 68.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.27 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 19.39 |
| Pfam Score | 92.69 |
| Assigned Pfam label(s) | PF09779- PF10476 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K1QFS3 | 13-260 | QPDDRPFYPVKVNCWFCSTDAVVPYGNKNCWDCPACQQYNGFNEDGDYNKPIPTQYNGDLNHPVSCAQGDYISNNDVLCENCTRNQL… |
| A0A1E4TAX8 | 3-433 | PVIKKVCLYCNELQEITGNPSWFRDAAAEWTCPNCSSVNNPSSYVSTYKREKYPMSLTDFPESPFCAVCEANQTMYISSLANYLPDP… |
| A0A5F8AAE2 | 166-508 | None |
| A0A0H2S931 | 7-496 | None |
| A0A0F7SX83 | 14-487 | None |
| A0A0F4YTQ7 | 6-438 | None |
| A0A1E3IMS3 | 4-429 | None |
| B8P8R0 | 1-360 | None |
| A0A4Q4VMY2 | 8-405 | None |
| Q3TXY3 | 3-345 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.