DPCstruct | MC20712
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 235 ± 37 aa |
| Standard deviation of domain lengths | 36.56 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 92.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 23.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A235EXA7 | 46-286 | LQVAVARLLGYRWPAETDADMELAIEARQWIAHTDKLAAHADDDGIVCLPAVRGEKPAHERLLALLIDAWETVTPGSWKASTLDRLL… |
| A0A7C1PJM1 | 85-375 | EADRRLIEEELAEETAAEEAEDTEGQVEEDAEAPAVAETATLSVREHIRRLLHYFAHRAIASDPDGIVPLAGLWLPDGRKEPGLAAR… |
| A0A7X9BPS9 | 2-158 | None |
| L0JRI8 | 153-355 | None |
| A0A847BQZ7 | 23-266 | None |
| A0A6N0ZBE6 | 359-638 | None |
| A0A482Z0M3 | 361-575 | None |
| A0A5E8HJ40 | 175-450 | None |
| A0A426U358 | 140-428 | None |
| A0A1E7IAV8 | 680-975 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.