DPCstruct | MC20706
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 191 ± 15 aa |
| Standard deviation of domain lengths | 14.61 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 25.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14943 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I7RVC8 | 9-189 | GKPPILPPSKTVRYHVVHVPWQEPEYVEELLWRRHVYNNAMISIKKVFKDEIRSKEEQGMGIEALREQELVELDELIAQNDERNRKA… |
| A0A6P8Z2Y5 | 5-224 | GTTFLKKSVVATGIDLIPQQNAICIQQARGLRPRKPAYSGIAKTKLFRIPKVPVYPPDEKAEIVRLGNQYRTFMKSIRNHFKLENQT… |
| A0A4Y7NL19 | 61-272 | None |
| A0A6J0ICX2 | 81-279 | None |
| A0A5S6QTB5 | 44-244 | None |
| A0A1Y1NB14 | 24-202 | None |
| A0A6A5D4S0 | 411-605 | None |
| A0A7R9P2R1 | 1-177 | None |
| B0XKC4 | 1-170 | None |
| A0A183CL20 | 10-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.