DPCstruct | MC20705
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 216 ± 27 aa |
| Standard deviation of domain lengths | 27.13 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 73.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 19.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6YVJ6 | 1-195 | MNVNWTEKEKEQLHDALQVYGTNDIDLITSLIPSRSKSEVQYTMQLYEAMAMKTVKNEGDRNREAAIDSWLKFFKESSTNCTRGNEL… |
| A0A6P8Y554 | 13-261 | RYMESPVPSKVARGAFSDMEDAQLLSALMKHGPVDISKLTALVPTRNEYQVKQRILVLQRKAQQSLTTVELGGNKRGPKYQARQKVA… |
| A0A7R9AFQ0 | 34-256 | None |
| A0A1B0B8V4 | 17-195 | None |
| A0A482WPW4 | 52-296 | None |
| A0A4C1TNF1 | 19-250 | None |
| A0A6P3DCJ7 | 1-205 | None |
| S4PEK8 | 4-228 | None |
| A0A821N0S8 | 9-220 | None |
| A0A812EKT6 | 1-243 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.