DPCstruct | MC20703
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 90 ± 4 aa |
| Standard deviation of domain lengths | 4.13 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 73.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 32.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0J6R2J0 | 1-97 | MGTASPLPAPAGSGEAVPTGSRAIASRDQAFDELLTIAAYFRQTEPHSPISYALETVVRRGRMTLLDLLGELIPEAEGRERFLRQAG… |
| A0A3M5WHR6 | 1-86 | MTQASQDSASAPLRTTPTTRDEAFTMLAGIAQFFKNTEPQSPVPYLIERAIKWGNMPLEGWLNDVIKDSNVVDSIRDVLGTKEPKQ |
| G7G5L9 | 50-137 | None |
| A0A809N0Q4 | 28-118 | None |
| A0A640VTJ7 | 138-231 | None |
| A0A7X9EL77 | 322-404 | None |
| A0A7Y9WAD4 | 149-241 | None |
| B9TCX4 | 116-202 | None |
| A0A2R7KX05 | 175-263 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.