DPCstruct | MC2070
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 112 ± 16 aa |
| Standard deviation of domain lengths | 15.64 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G7P2L0 | 1-91 | MPQSSQTTVFVVMNGDIPRSVAADLATAQASALARQTAWSGTDKWDYRWDEYLPGEVWRLMQRRKGPEGKGRRYSWSMYAVHAVEFL… |
| A0A1S2K850 | 38-146 | ALYAHMAEALAAKLLIGPAAPQLVYRAGYRSLPLGWYATADAARRCCESILSDQHPADVALLFDWSGEVLEHGERCALLAEIDGVQE… |
| A0A4S2TBK6 | 12-154 | None |
| A0A1I4C4I2 | 232-332 | None |
| A0A561EN67 | 242-344 | None |
| A0A1G9TIH4 | 55-173 | None |
| A0A4Q9HYA7 | 85-187 | None |
| A0A5C8QM51 | 169-297 | None |
| A0A066YZT6 | 69-197 | None |
| A0A100J3C8 | 257-366 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.