DPCstruct | MC207
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 239 ± 36 aa |
| Standard deviation of domain lengths | 35.73 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y0BFQ3 | 4-235 | LQPLIASINSAVNVILLSMHREPGLNSSNISTTGPSLYMKELQDFIVRSWNTHILPFNDRAVIEEAGRNLAIRCIELFVQNLATIRP… |
| A0A7S1IFE2 | 54-291 | SIIRPILTSATKYLEKLVLKLHKEDFQNPDLNRTSSYISDIENRLQAIKHKVLYLFDATTTPYEYSCRQMAARVVSFFIRQASLHQP… |
| A0A4S2L9V9 | 450-732 | None |
| A0A2U1MCW3 | 554-807 | None |
| A0A7I8VVL3 | 493-740 | None |
| A0A7S3PQ90 | 249-525 | None |
| A0A1I8IQF4 | 4-196 | None |
| D3B815 | 1-137 | None |
| A0A815GPV7 | 974-1210 | None |
| G0NJT2 | 63-279 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.