DPCstruct | MC20693
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 113 ± 9 aa |
| Standard deviation of domain lengths | 8.80 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 36.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J4KT87 | 474-589 | LPEDQWRDLWWNLIAMVDPEAAIADYNTMSSNYNNEAGESKAHTYHWLHTFNKIGHIQTGTGDITSNYPAALVFKKGNITNYLAYNF… |
| J5KQG5 | 18-135 | SGLPEDQWRDLWWNLIAMVDPEAAIADYNTMSSNYNNEAGESKAHTYHWLHTFNKIGHIQTGTGDITSNYPAALVFKKGNTTNYLAY… |
| A0A3D4BW22 | 296-409 | None |
| A0A2K9EFV1 | 139-244 | None |
| A0A2S8R7Y2 | 276-383 | None |
| A0A3E1EJK6 | 4-100 | None |
| A0A166RCE5 | 668-794 | None |
| A0A5C7Z1L0 | 124-240 | None |
| A0A1V5LUI6 | 316-419 | None |
| A0A2A3HQ21 | 11-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.