DPCstruct | MC20691
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 72 ± 11 aa |
| Standard deviation of domain lengths | 11.14 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 92.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 51.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| N8WB60 | 150-228 | AFVWGDNVNFMEKRYAAMVQHPLFAGMKLSEDKAEIQQWAPLVMDGRDPQQKVAATRMDVGSDVNYGAITKQLIGNLEK |
| U3U5W1 | 1-57 | MSFVWGEANVAFLRKRFPALQKSTLFRGMNYSEDRDQIAEWIPLVMNGRDRKQKVAA |
| A0A447XHS8 | 1-81 | None |
| A0A812W059 | 1081-1155 | None |
| A0A5N9VY81 | 30-97 | None |
| A0A2S6VSM0 | 72-123 | None |
| A0A822PHQ8 | 56-110 | None |
| A0A6N6X3I0 | 15-101 | None |
| A0A377TYT9 | 21-99 | None |
| A0A0M0JBW7 | 30-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.