DPCstruct | MC20688
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 264 ± 29 aa |
| Standard deviation of domain lengths | 29.22 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 22.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06761- PF14331 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P8JT99 | 272-461 | RVLRLMLLAIVVLWGAGTLLSLVVNRAQIYQAQETARVAADTRQPLPERLRNQLLLQQAIARLQDRQSHGAPWYTKFGLNQDGDTLN… |
| U3U1Z3 | 1-285 | MGELSRALHLPGQRSGESGSWDQVDKESPIPPNKGQSFFLKGVLENVIFQESGLAGSNRWWELRNRAGLWSDYLALLVLVLIAGALW… |
| A0A356SZQ8 | 376-657 | None |
| A0A484W0B8 | 1-281 | None |
| A0A4Q1VPF3 | 179-463 | None |
| A0A377XBL2 | 204-416 | None |
| A0A1I3NGR2 | 55-317 | None |
| D0XF20 | 378-633 | None |
| A0A2X3CIW1 | 26-319 | None |
| A0A1F4BKS2 | 381-646 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.