DPCstruct | MC20685
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 47 ± 1 aa |
| Standard deviation of domain lengths | 1.22 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 88.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 70.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U3TXY6 | 1-48 | MKNILAIQSHVVYGHAGNSAAEFPMRRMGANVWPLNTVQFSNHTQYGH |
| A0A2G0Q1V7 | 1-48 | MKNVLSIQSHVVFGHAGNSTAVFPMNRMGVNVWPLNTVQFSNHTQYPQ |
| A0A6A5KYU4 | 657-703 | None |
| A0A6G0J7B0 | 3-49 | None |
| A0A2K5C3E7 | 2-47 | None |
| A0A3Q0CHY6 | 2-48 | None |
| A0A6A3JLJ6 | 12-55 | None |
| A0A6A4S867 | 1-46 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.