DPCstruct | MC20684
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 118 ± 21 aa |
| Standard deviation of domain lengths | 21.09 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 86.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 31.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08482 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6F8QBM0 | 61-158 | IAISLAEVRALFADRIAWHDLCEWSRRDRRVIARQQERLGAIALDDRIWKDAPEEAVARAMLDGVRDLGITLSDAARRFTARVALAR… |
| U3TSU5 | 1-134 | MLLALPVEIDTLRQQCPQLVEQRTDVDWDEDKGTLRAWKREAIGALILRAQPQARPEPEILHPAMLRWIREKGLAVLGWTPEAEQLR… |
| H6SRG5 | 291-416 | None |
| A0A0K2RSU2 | 103-213 | None |
| U3GSJ6 | 723-881 | None |
| A0A3M3PBF5 | 461-591 | None |
| A0A447Y2E2 | 26-158 | None |
| A0A1Y5Q4Q4 | 243-363 | None |
| A0A3P3U5L3 | 629-746 | None |
| A0A1V1VZF8 | 580-652 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.