DPCstruct | MC20682
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 123 ± 21 aa |
| Standard deviation of domain lengths | 21.20 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 88.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F5SV76 | 2-97 | ARPLRYAGSLSCKDCHEEKHLSWSKSRHKTVNCETCHEAALKHTEDPAIKPTKPEGRKFCLLCHAKNISKPKNFPQVDPQGHNPGQN… |
| A0A399WQZ8 | 7-143 | RLILAFATLVVGFLAFRSQVVPDSFGETGFYRADSVKEIGDLPMKHAGEETCATCHSDFAEATSHVLGGVACESCHGPSLAHAEDGA… |
| A0A7V5AN37 | 11-148 | None |
| A0A1F5YXE7 | 58-176 | None |
| F2KRJ2 | 20-124 | None |
| A0A0F2IV98 | 10-143 | None |
| A0A7C4TST9 | 30-135 | None |
| A0A1E7GN65 | 6-132 | None |
| A0A7V1ARH1 | 2-80 | None |
| A0A7C3EN21 | 138-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.