DPCstruct | MC20680
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 203 ± 30 aa |
| Standard deviation of domain lengths | 30.15 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S8KWM4 | 259-422 | YRTQTPGGWGAPPAGNNPGAYLAANFGDVFSTGLEVGDPNTILLTSAAAIETLLPTGGRPAVLTESCVDPTRIKNVLVGHVVALTLS… |
| A0A351MGL3 | 126-307 | FSVEDDYPFHAAYRTYSQGGYGQDAGTNEPGQLLSAYWSGDVVIGHADGYTLTFTSPAAVRAFLPAGGKAGALSASATDPTSSSAGV… |
| A0A7Y3HM01 | 44-222 | None |
| A0A7V9PMC2 | 36-270 | None |
| A0A7Y5RT80 | 180-376 | None |
| A0A0G1P426 | 8-279 | None |
| A0A7S2SA30 | 211-455 | None |
| A0A1F2SQC3 | 191-369 | None |
| A0A2G8DLP3 | 523-723 | None |
| A0A1I1Z662 | 20-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.