DPCstruct | MC2068
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 122 ± 16 aa |
| Standard deviation of domain lengths | 15.98 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 26.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G5S256 | 3-123 | NAEDVMGMSHLTFVRNFMKRYGVYVKRRISGTPVPAEVNHGRWIVKCPFCAGAEVISTHDPVFYCLSCLNIKNDGDLLPVLIPDNYR… |
| A0A1Q5H0N5 | 31-133 | DWSQVPGAELIYRWAETRLNRRVPVPTETVPDHPGLYARIDDGRWIGICDACDSVWIVSVKDPRFGCVECRRDWVPLIVPDDIAGAE… |
| A0A2T0KJH5 | 2-96 | None |
| A0A3A4TS31 | 20-145 | None |
| A0A1Q9TG85 | 22-156 | None |
| A0A6M3JSM0 | 1-140 | None |
| A0A7M2YV67 | 22-130 | None |
| A0A3R9WD86 | 1-123 | None |
| A0A2N2LCD2 | 6-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.