DPCstruct | MC20679
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 125 ± 9 aa |
| Standard deviation of domain lengths | 9.43 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 75.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 30.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0172 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M1SY68 | 486-614 | LTGSRAQIKSVADAAGFGYRFDTDSQEYSHGAAVFVLTPEGKVSRTLYGTYQLPKTTWLSLVEASDGRIGSPTDRILLYCYHFDAQT… |
| A0A351AFU8 | 21-150 | QFLVGEEKEVRRLADAVGFKYTYDAKSNNVVHPAGIMVLSPAGNVSRYFVTTEYSAFMIREALATANEGKMGPRDERPFYLACIDID… |
| A0A7V6CRK4 | 1-106 | None |
| A0A2Z3GZ44 | 160-302 | None |
| A0A350FF02 | 1-130 | None |
| A0A2V5ZKF0 | 70-203 | None |
| A0A536W0E9 | 616-736 | None |
| A0A3S0E486 | 57-176 | None |
| A0A7C3TSK8 | 293-420 | None |
| A0A7V8SXS7 | 97-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.