DPCstruct | MC20677
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 370 ± 37 aa |
| Standard deviation of domain lengths | 37.23 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 18.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14656 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D4ISR2 | 1-379 | MDVLHAHSCWEYVVQWNKDPEEAHFLIRAIEHLRCIDNAHVQHGIALMMWNTFLVKRLSAATYLMDKVGKAPKDRLCRRDVGMSDNA… |
| A0A7I0ZAL0 | 29-354 | NYLTANMCWEYAMEWQKHMSKTEVLEAVVHCLENITDLYLRLGLFSIIWSTYIRHIFEASCRLVNKVGKLPKDHLCLQDLGFNSECL… |
| A0A0R3RJG1 | 569-958 | None |
| A0A7S2EAH8 | 381-758 | None |
| A0A7M5UT96 | 506-872 | None |
| A0A4C1Y832 | 164-591 | None |
| A0A3P7JYC9 | 2-302 | None |
| A0A817F1W9 | 146-539 | None |
| A0A834VHJ8 | 282-694 | None |
| A0A553PCB0 | 844-1212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.