DPCstruct | MC20676
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 179 ± 28 aa |
| Standard deviation of domain lengths | 28.09 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 70.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 35.83 |
| Pfam Score | 87.19 |
| Assigned Pfam label(s) | CL0081- PF14048- PF02008 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R7UD31 | 2-156 | RHDANLVLPIRQTASIFKQPVTVIRNRPESITRSDLKHGPQEQPKQLFWEKRLEGLHACDTNEERFKSLDLPHNIQGAGPNLSTENL… |
| A0A7I0Z153 | 37-212 | TMLLCKVKKQARAQYEYNRGFRSDASLVPPIRQTASIFKQPVTVYKTQESKVKTDLKQGTQEKPKQLFWEKRLEGLTACDANGVIGT… |
| A0A194RD56 | 44-234 | None |
| A0A3Q1EG39 | 2-180 | None |
| A0A2A2KFQ8 | 1-157 | None |
| A0A0V1ACN0 | 22-201 | None |
| A0A6P6CI33 | 1-177 | None |
| G1T1U1 | 37-204 | None |
| A0A6F9CTB6 | 280-408 | None |
| A0A7R8X1H1 | 565-786 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.