DPCstruct | MC20673
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 241 ± 50 aa |
| Standard deviation of domain lengths | 50.00 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 77.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 19.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04938 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0J7L2V8 | 7-154 | YIKTLAGCVQAPPSLSPTLEWQQYQVSDFSDIRLHISQLKDEIQVGKRKWRSPDINLPDINDQEAWISFCLGSKEKIEPTLNTLFCF… |
| A0A212FM38 | 2-196 | KERQNYSTVTTCNRDFSKFARNQSCFVKELPHAKAPESLKPTIEWQNIQVADFSKVRMYISKLISNRSLWPRDVINIEIDPDNIAAW… |
| A0A068UP61 | 120-415 | None |
| A0A7S3BGW7 | 5-261 | None |
| A0A812ZD58 | 10-301 | None |
| A0A816JRW5 | 333-558 | None |
| A0A0F7SB91 | 8-337 | None |
| A0A0K9QLW6 | 329-567 | None |
| A0A7J7KU10 | 1-286 | None |
| A0A4V1IYE5 | 51-289 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.