DPCstruct | MC2067
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 90 ± 8 aa |
| Standard deviation of domain lengths | 7.67 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 32.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R9MUQ0 | 5-91 | KQYFLLYSCNEWKAFSSMRLVGVSMDLNVIYIMVGSKIKTGDMLYQSDNKKESWEIFQRDYRLGEVELDQLKYGFVDIYEEYSVSSR |
| A0A415MED3 | 1-107 | MAQQIYYLHSCNEWKEYSSMRLLFIGTSQQKLKMKISKEIEEGNMEYKPVTTYHDWDGEHIICKEKENTPKQQAKLFRQDWETETRD… |
| A0A1H9B1W3 | 1-82 | None |
| D9RAN9 | 1-88 | None |
| A0A1Y4GY61 | 93-184 | None |
| A0A3A6HNL3 | 3-101 | None |
| A0A6N9P325 | 1-92 | None |
| A0A7X5CDM1 | 15-97 | None |
| A0A3D0M0Z8 | 4-87 | None |
| A0A417KXB7 | 116-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.