DPCstruct | MC20666
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 85 ± 9 aa |
| Standard deviation of domain lengths | 8.87 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 48.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A850EF93 | 1-76 | GNNAAAELLGVATKPYHQKAYVTCLDLGAAGALFTRGWDRKVEMVGDMAKKTKHEINTVWIYPPRAERVAALAAAD |
| A0A7X1TY99 | 571-658 | MSCQHANRLGASAGHNAAADLLGVPLEPYQQKNYVTCLDLGPSDAVFTRGWDSKVEMTGDKAKAMKREINTQWIYPPRANRADAYKAA |
| A0A176YUY2 | 14-85 | None |
| A0A7K2R8I2 | 44-132 | None |
| A0A0M8TE99 | 307-405 | None |
| A0A084CE11 | 11-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.