DPCstruct | MC20663
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 178 ± 21 aa |
| Standard deviation of domain lengths | 20.70 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 76.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 34.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14973 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B4ECT6 | 56-213 | PCSIRVVAAEAWMVVRARDIKHFERVLEFLDVIHTLLPHLVTSIKHMKIIFGLKTLVIMWMLWDDQSMDSITDKIARFFPDHLPQYR… |
| A0A6A4SA10 | 26-186 | VRLVSAALWKALKRRDVTQYGVVEEFVTSACETVPGLLTVRHQGKLTLGLRGRLILELCRTQPDPEVIEPHLRRIRAPASPPSSSSA… |
| A0A6J3GT61 | 1-169 | None |
| A0A6J3EH84 | 424-604 | None |
| A0A1S3QVE1 | 135-318 | None |
| A0A4W5KJ84 | 9-186 | None |
| A0A553N0D1 | 27-221 | None |
| A0A4Z2G9F9 | 1-163 | None |
| A0A6J2VJV6 | 2-157 | None |
| A0A7J6D663 | 1-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.