DPCstruct | MC20660
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 144 ± 11 aa |
| Standard deviation of domain lengths | 11.09 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 32.21 |
| Pfam Score | 82.14 |
| Assigned Pfam label(s) | PF17869- PF00095- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9PH28 | 19-156 | RCTSVCWRPGKINSTCVSSCVSTPVVKPGHCPNAESLTVFDTVCLDACSQDSACPQTHKCCRHDCGATCQEAQGLRTVPGLPDIPSN… |
| A0A1W4WIU6 | 45-188 | TVICEARCWNTTNKNRCVKACLMKGVDKPGSCPGLDSTGGSRFAFACLEACNKDIHCPGLTKCCNHRCGITCQIPKNLNNVKDVPEL… |
| A0A183BJU0 | 189-346 | None |
| A0A0L7K3J0 | 3-133 | None |
| E9IS66 | 1-136 | None |
| A0A6F9AY96 | 145-299 | None |
| A0A0N4UGY7 | 13-170 | None |
| A0A0C9QU84 | 36-189 | None |
| T1G862 | 1-129 | None |
| A0A662YUK8 | 50-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.