DPCstruct | MC2066
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 78 ± 10 aa |
| Standard deviation of domain lengths | 10.45 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 94.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 37.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U3LNI5 | 51-122 | LSVVLIWESDPTSVGYFNSAKGVADAKQAITEAEYLGAPNGTDLYFTVDYDALSSDMAAIVEYFSGVREGLA |
| A0A7R8B1H9 | 135-225 | AVVYQDAQDGIEHFNGVKGKASAKKALEQAADIGQPAGSAIYFACDFDPSADETRGPVTEFFHAVNAELAAATVSYKVGVYGSGLVC… |
| A0A6L4ZPV7 | 56-149 | None |
| A0A4R2JZZ6 | 430-504 | None |
| A0A1S2I427 | 399-468 | None |
| A0A1I7IZD8 | 63-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.