DPCstruct | MC20659
Metacluster Properties and Pfam Annotations
| Number of structural domains | 121 |
|---|---|
| Mean domain length (aa) | 135 ± 25 aa |
| Standard deviation of domain lengths | 24.72 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 79.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 16.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0051 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R1ISA7 | 2-84 | KLALTKLEQNESFQNKIGIPYDYSLNTGKIGGHDAKGYAEMDLDIEGDSGDGVFFFKASHTNLNWQLDCLTIQFADTQETEIV |
| A0A6A4S1D0 | 17-138 | TGGLLYVVFQELFSTSSPNKIYGKAFDKVKSYPEVIGAFGEPIKCYGETTRRGRRQQVSHVEYLKDGLKHMRLKFYIEGSEPGLKGT… |
| C1MSP4 | 18-213 | None |
| A0A565BNS2 | 166-313 | None |
| A0A846NUP9 | 11-142 | None |
| A0A0B7MW95 | 848-999 | None |
| A0A5B8MQU0 | 141-271 | None |
| A0A6A7FW89 | 130-287 | None |
| E2C6T3 | 4-98 | None |
| A0A1S8VAP1 | 7-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.