DPCstruct | MC20653
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 96 ± 9 aa |
| Standard deviation of domain lengths | 8.86 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 59.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0351 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U9CTB7 | 2-101 | QAAMDITAKYCHKEMEEYGSCVASNPSTWQHKCHELKMKVAQCTSSHPVIQKIRQDCSKEFVEFERCLRENQDQLTSCSPHVARFLG… |
| A0A2I0LLJ5 | 1-81 | MEQYGRCVAASPASWQRDCHGLRLSISRCAAAHPIVQQIRRDCAGPFAAFEQCLKENEAAVTNCSDHVNAFLLCADRVKGS |
| A0A7J5Y9U6 | 87-201 | None |
| H3C497 | 2-83 | None |
| A0A4U1EGF3 | 24-134 | None |
| A0A2G8LKR9 | 3-84 | None |
| A0A4Z2HZG7 | 2-96 | None |
| A0A672UX63 | 129-222 | None |
| A0A6I8PLK2 | 191-286 | None |
| A0A6P6BRJ9 | 2-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.