DPCstruct | MC20651
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 87 ± 17 aa |
| Standard deviation of domain lengths | 17.14 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 74.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 57.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10536 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A061ENC1 | 161-277 | QQNDFTEMVGIWEQWRRAHRDNFQNKYGHIAWLLYVPVDDQMLRAIVQFWDPSYRCFVFNKVDMTPTIEEYSSLLRIDHMQPDKIYW… |
| A0A7J8WA49 | 21-96 | DLPYLLDIKVDKHLFRALAQFWNPAYSCFTFGGGDLVPTVEEYMTLLRCSKIQVDRVYSRAVNNLRDLILAYPHME |
| A0A7J9FMI0 | 36-111 | None |
| A0A7J9FQH0 | 36-123 | None |
| A0A7J9LU34 | 60-145 | None |
| A0A7J9M312 | 115-212 | None |
| A0A7J9M4S0 | 15-118 | None |
| A0A7J9FBR6 | 3-85 | None |
| A0A7J9CZS9 | 1-79 | None |
| A0A7J9D059 | 37-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.