DPCstruct | MC20650
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 100 ± 17 aa |
| Standard deviation of domain lengths | 17.13 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 68.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 54.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8NGQ7 | 1-70 | MLQISYMDEKEALFSFMDGLKPWAKQELQRRGVQELTKAMSVAESFAEFGGKKDKFESSKPKFNPKGNIV |
| A0A7J8W9K9 | 1-88 | MLQVSEVTEEEALLTFQNGLKPWVRQEVEKRGVQKLSKAMTVVEFVVKLGLRKDKLGSSKSEERGVCEMDHKKDIVDGNSNDDNGGLG |
| A0A7J9D2I5 | 1-107 | None |
| A0A7J9IBP8 | 1-88 | None |
| A0A7J9KDQ0 | 1-107 | None |
| A0A7J8WBF0 | 1-136 | None |
| A0A7J9ND61 | 1-107 | None |
| A0A7J9FE56 | 1-103 | None |
| A0A7J8W781 | 1-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.