DPCstruct | MC20647
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 74 ± 7 aa |
| Standard deviation of domain lengths | 7.22 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 55.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N9I7U5 | 2-65 | FLTAFGVWSWIIWITFAKNLWDSDRAWAADGSPTAYFIVHAVLTVVSFVLGTVIGVIGWRALRA |
| A0A1H9IK93 | 1-69 | MSLFLVAFGVWSWVIWPTFLKNIWKDPRSFSDGPTAFFTVHLVLVIASLVFGTVIGVLGVRGYLATRRR |
| A0A1I6DVZ5 | 29-103 | None |
| A0A6B1K0C2 | 1-65 | None |
| A0A1C5D5V1 | 190-267 | None |
| A0A3N1PQN5 | 1-78 | None |
| A0A1R1S589 | 7-84 | None |
| A0A6J4KXR8 | 42-108 | None |
| A0A3A3YYY8 | 1-70 | None |
| A0A4V6NBH7 | 1-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.