DPCstruct | MC20645
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 266 ± 63 aa |
| Standard deviation of domain lengths | 63.48 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 76.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 35.92 |
| Pfam Score | 76.47 |
| Assigned Pfam label(s) | PF05003- PF11961 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P6TCU7 | 185-340 | VSTNMDELLKIVATDKREELKIFAGEVVRFGNRCRDSQWHNLDRYFAKHSRDPQKQMREEAESIMQQLMILVQNTAELYQELHALDR… |
| A0A1S4DVB6 | 5-291 | KKELLQSEGIKQLISPSLEELLSIAAADKRQEFGVILREVIRFGNQCKDSRWHNLDQYFSRLDSNDSSQKQAREARAAVQELTVLAQ… |
| A0A1B6PQG1 | 285-629 | None |
| A0A7I4F4L6 | 197-497 | None |
| A0A1D6G7T2 | 13-234 | None |
| A0A453C078 | 1-201 | None |
| A0A453HI89 | 2-254 | None |
| Q84K32 | 1-366 | None |
| A9SW06 | 61-355 | None |
| A0A6A6MH01 | 1-370 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.