DPCstruct | MC20644
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1193 |
|---|---|
| Mean domain length (aa) | 182 ± 39 aa |
| Standard deviation of domain lengths | 38.59 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 79.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 15.03 |
| Pfam Score | 99.32 |
| Assigned Pfam label(s) | CL0125- CL0220- CL0356- PF00183- PF19437 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A150FXL4 | 23-165 | VVRREIPADNSCLFNSIGYVMHKSKTRAPHLRNVVARQVAGDRTTYSDAFLGMSNEAYCSWIRQPFNWGGGIELSILAQAYSMEIAA… |
| A0A1S4DUT3 | 46-200 | PSVDEAASDHERLLDRLQVYDFVERKVQGDGNCQFRALSDQLYGTPDNHELVRQKVVNQLMAHPEIYEGYVPMAYDEYLEKMSRNGE… |
| A0A7E4WEA0 | 395-539 | None |
| W5M3T7 | 48-297 | None |
| A0A7E4W0Y1 | 641-802 | None |
| A0A7E4VQZ5 | 1021-1175 | None |
| A0A6S7NFQ7 | 134-326 | None |
| W5MR22 | 16-152 | None |
| A0A821QUE2 | 179-347 | None |
| A0A7S1V4T9 | 1-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.