DPCstruct | MC20641
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 191 ± 36 aa |
| Standard deviation of domain lengths | 35.87 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 33.59 |
| Pfam Score | 95.26 |
| Assigned Pfam label(s) | CL0059- PF19292 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A259S5K2 | 33-228 | SRLESIRLADGSVHFDGLKFQAADDPESTASDWLQWRMIEGAIGRLPDTFYSGVWTLLAHTPALVIGDRYNPRNTLDSALLRSQSTA… |
| A0A6B0RAZ8 | 163-324 | WIIHAMEYELQIHGGNKPARDLYQLSPSEVKQLLLDILQPQQNGRCWLNRRQIDGSLNRTPPGFYDRVWQILERTPNGIIVAGRHLP… |
| G0PHD8 | 45-265 | None |
| A0A6L5CTH6 | 168-362 | None |
| A0A0R3Q6P5 | 11-182 | None |
| A0A7R8H5W2 | 363-628 | None |
| A0A816VXJ1 | 264-419 | None |
| A0A2C9JLV8 | 1060-1259 | None |
| A0A7M5WZH5 | 663-857 | None |
| A0A1I8ILZ9 | 562-758 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.