DPCstruct | MC20640
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 105 ± 9 aa |
| Standard deviation of domain lengths | 8.74 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 19.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y4J0E8 | 1-110 | MNYYGIMTNYEERMEANLEQYSRPEKAGTFILRLDYRTWGKRMCLFCYFTDEDTGEKIRLACWRNAKEHYAPRKCTAIDFARVPTNS… |
| A0A6H3CQP1 | 1-123 | MEKDDTRRAMSYNAAIEAGLEPRTYEFKNVPEGVWAARLDFKVWSNKSAAGHLRCYFTSHADNSRYLLSAFRPTQPGSRRYSPKDDG… |
| A0A316B9P9 | 2-114 | None |
| A0A2V2S538 | 14-113 | None |
| A0A7U6J3G4 | 2-89 | None |
| R6TK13 | 1-98 | None |
| A0A1M3CJM2 | 4-106 | None |
| A0A6I1BCC1 | 14-111 | None |
| A0A174UR36 | 13-114 | None |
| D2U2V9 | 18-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.