DPCstruct | MC2064
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 85 ± 12 aa |
| Standard deviation of domain lengths | 11.64 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 93.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 35.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F9JSN0 | 1-97 | MTSKERVKKAINHERTDKVPVDLGSSFETGIHAYSYKELKECLNINSGNIEIIDTLQFIAKVEENVIERLHIDIVPLRVRYDPLGIK… |
| A0A0F2J5A0 | 1-96 | MNSRERLIKTLNHQQPDRVPLDLGGTSQTGISASTLYQLRKALGLEEKPILVHEPSQILGMVDEDVLKKLGADVVGLWNPYTFMGYK… |
| A0A0F9CJR4 | 5-95 | None |
| A0A117M7U5 | 1-63 | None |
| A0A7X7IMR9 | 1-83 | None |
| A0A1Y0N1G0 | 1-95 | None |
| A0A2D5YXQ7 | 275-382 | None |
| A0A0B7MCG9 | 4-80 | None |
| A0A7Y8L4R4 | 20-92 | None |
| X1MQV1 | 1-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.