DPCstruct | MC20639
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 166 ± 19 aa |
| Standard deviation of domain lengths | 19.23 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 20.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A4ENP3 | 68-266 | RHRSALHDARCVLTTRTYQPDELVVRKAYDVAVGFAHRMRFVRRWEFHYAAVQQLWPSFTMKRFATVLACADVLNLWSYPNLRDEDL… |
| A0A6H3CNY7 | 3-174 | TTPRFDHANLSKEANPLDDCILAQRTRRFRGMEPDGYDDARGEQLRKQFINDENLKTAYAFCLALCGKGNLPKSHFRSMIARADKKR… |
| A0A629KHP5 | 99-266 | None |
| A2SND9 | 29-192 | None |
| A0A383SAA7 | 1-135 | None |
| A0A0N0FVV8 | 2-164 | None |
| A0A2J6MQ70 | 6-199 | None |
| A0A315AIU1 | 1-143 | None |
| A0A268UC33 | 43-204 | None |
| A0A494Y5B4 | 6-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.