DPCstruct | MC20638
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 67 ± 5 aa |
| Standard deviation of domain lengths | 5.27 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 50.68 |
| Pfam Score | 93.33 |
| Assigned Pfam label(s) | CL0229- CL0208 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C4J981 | 105-167 | DVPYLPKIHWSKNSRLKDVICQFQAHLKILQEFWNTMDEIDKVLWIVDPTKPSYAMSHRRIAL |
| A0A3P4NGM7 | 168-242 | DFPVSFAVSWTPQSSLISIYGQFLAALESLKAFWDVMDEIDEKTWVLEPEKPTRSATARRIALGNNASINIEVDP |
| A0A0D2RFZ6 | 76-152 | None |
| A0A484NGF8 | 75-141 | None |
| A0A0P0W2F9 | 5-69 | None |
| A0A287N591 | 9-70 | None |
| A0A4Y1RNE2 | 97-158 | None |
| A0A453H9W0 | 55-117 | None |
| A0A7S4L662 | 172-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.