DPCstruct | MC20633
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1041 |
|---|---|
| Mean domain length (aa) | 139 ± 39 aa |
| Standard deviation of domain lengths | 38.77 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 85.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.81 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 31.40 |
| Pfam Score | 96.50 |
| Assigned Pfam label(s) | CL0004- CL0689- CL0220- PF11617 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7L6AMI8 | 58-205 | DTDGDGLSDGTEVNTTKTDPLKPDTDGDGLPDGTEVNTTKTDPTKADTDGDGLPDGTEVNTTKTDPTKADTDGDGLPDGTEVNTTKT… |
| A0A830FRH4 | 9-148 | LPNSYERSVTQTDPTQADSNGDSVIDGLEDWDSDGLVAYAEFREGTNPRDNDTDGDGLSDGFENPIQGLDPANLDTDKDGVTDDKED… |
| A0A1V5ZHE0 | 598-782 | None |
| A0A330MRW2 | 121-281 | None |
| A0A1V5ZCW0 | 607-718 | None |
| A0A7W0Q787 | 89-247 | None |
| A0A2E1VNS6 | 232-395 | None |
| A0A2R6G2Y1 | 81-176 | None |
| M0D9Z1 | 60-236 | None |
| A0A1V5ZIU7 | 412-552 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.