DPCstruct | MC20629
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 385 ± 30 aa |
| Standard deviation of domain lengths | 30.10 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 75.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 16.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A844MVX7 | 1-343 | MKYLLPLTNNEFLLWYRRSELKIMKFRLIPIVDVDFADDTSKLDKVAARVVEEMPDYDEDYEVLIARVEDISRVPHYCFDEGKPTFI… |
| A0A069SG74 | 1-413 | MTNYLALMRKQDFADLYKYGIFHANRDMIRKFDCSIEDLKNNPEFFREILILANAFDSSFTYVFVHYSKKFDNSFFENIEVEDVQNI… |
| A0A5M6DLD7 | 1-398 | None |
| A0A4R0DX35 | 2-363 | None |
| A0A7T9J1C9 | 50-378 | None |
| A0A662ZG87 | 1-417 | None |
| A0A6N6SLC7 | 2-403 | None |
| A0A023RJ14 | 1-402 | None |
| A0A2N3I335 | 1-398 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.