DPCstruct | MC20627
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 96 ± 14 aa |
| Standard deviation of domain lengths | 14.06 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 25.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14302 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A069RZX4 | 2-85 | YVSSETGIMYDLFDSEGEFPIECMLVKEQGEDEYRPLAFCSIQGFEYEKGYEYDLRVNKTTLANPPADGSIYKYQLVRVVEKRQ |
| A3XMU2 | 2-81 | RINHFQNTGIGEAAMLTLLVQTGDAIGTETWTKFYSTIEGFDYEPGRVYDVTLKTTPINNPPADGSAVSYTLLDITSTQE |
| B0JH60 | 47-131 | None |
| A0A5B1BFV3 | 13-101 | None |
| A0A6N3HNM5 | 14-114 | None |
| A0A644Y344 | 26-129 | None |
| A0A2T7UCS2 | 96-187 | None |
| A0A0B8T330 | 10-117 | None |
| A0A2G6F899 | 6-97 | None |
| S7X7K5 | 4-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.