DPCstruct | MC2062
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 128 ± 21 aa |
| Standard deviation of domain lengths | 21.00 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3C1KT53 | 10-154 | KEDVEQFVTTTVRKAMWRVQRELDKQGWHATLHEEEAPARLWLEVTKEEAVDFIYEIRLLEHSLPHYAFPEMTHHGADVAHYYRAEV… |
| A0A2R7NPX2 | 6-114 | RFMDDTVKPAMEAVAEQLGEQGWDVQTRFEAGDMELSVNHGEQQDFLYRVILSGYLTPSFAAQQLRNQRYYRAEVHLYEGSQDYDLV… |
| A0A133ZAT1 | 43-155 | None |
| A0A127GZG0 | 528-658 | None |
| A0A7J9V5E4 | 1-90 | None |
| M1UGS9 | 6-127 | None |
| A0A1G5JYI9 | 3-119 | None |
| A0A4V3BM87 | 145-333 | None |
| A0A376TL58 | 54-183 | None |
| A0A2G6JRR4 | 26-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.