DPCstruct | MC20615
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 113 ± 13 aa |
| Standard deviation of domain lengths | 12.76 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 20.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E5FEX9 | 5-104 | AFSATPVMSHLGMNAYLLNIDCRSAYEAKFDIQSQDPRVFDGDRVELQRLIGQLRAVVSIDCPSIRRITVKGTVNKKLYFAGASEKG… |
| A0A2A5H980 | 20-126 | LTCLIASKGNADSVLLATHKDVSVFLLSCDQHVAHIEIQAKHAAVFTQAKSGAGKFLRTMKYIVPGRCKDVAQVKVKGTVEGKLWFA… |
| A0A7R7JB80 | 3-121 | None |
| A0A6L3ER18 | 18-119 | None |
| A0A3B0Z9J8 | 15-122 | None |
| A0A2E6QMN8 | 16-117 | None |
| A0A850F6H6 | 1-119 | None |
| A0A1Z9X2N7 | 1-89 | None |
| E6VY80 | 1-127 | None |
| A0A448SKC9 | 1-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.