DPCstruct | MC20612
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 113 ± 8 aa |
| Standard deviation of domain lengths | 7.61 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 71.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3G8W7F5 | 258-365 | NSNKTFKKEISNEKIKALVKCKLNFSIQTDDLSREALRVERIIEENNFSCRVYTENRLASVGLSIFLPNIIGVATLAGIAAHNLLTL… |
| A0A2V4EZF8 | 15-125 | YNFNSFKSTEISDQFINTLIEQKMSFSIEAENIQQEVERVERLIEAKGFSCRVYTENRSLLCAGSLGSGSIKLLGLLSLTYIAIHNL… |
| A0A432VRK8 | 1-109 | None |
| E6BGM6 | 6-118 | None |
| A0A2D8HTA3 | 2-113 | None |
| A0A560I2R0 | 1-106 | None |
| A0A1A7PBW9 | 1-101 | None |
| Q7MNB3 | 10-139 | None |
| A0A3G8W387 | 175-294 | None |
| A0A5K4Y8M8 | 2-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.